PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36879.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 100aa    MW: 11655.5 Da    PI: 8.184
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36879.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB149.37.6e-471781794
         NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
                  mkk++Pan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfe+y+eplkvyl+kyre+ 
  MLOC_36879.1  1 MKKAIPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKVYLQKYREVR 78
                  9***************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.06E-31178IPR009072Histone-fold
PfamPF008086.7E-22155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.2E-42178IPR009072Histone-fold
PRINTSPR006152.8E-231937No hitNo description
PROSITE patternPS0068502238IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-233856No hitNo description
PRINTSPR006152.8E-235775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MKKAIPANGK IAKDAKETVQ ECVSEFISFI TSEASDKCQR EKRKTINGDD LLWAMATLGF  60
EEYIEPLKVY LQKYREVRAY LVMWQLFSTN WEWISALGVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A6e-411761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B6e-411761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
1n1j_A7e-411761893NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3641761e-166AK364176.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022G14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001106052.24e-50nuclear transcription factor Y subunit B
RefseqXP_003568278.14e-50PREDICTED: nuclear transcription factor Y subunit B
SwissprotP252096e-52NFYB_MAIZE; Nuclear transcription factor Y subunit B
TrEMBLF2DJV83e-69F2DJV8_HORVD; Predicted protein
TrEMBLM0VSH81e-69M0VSH8_HORVD; Uncharacterized protein
STRINGBGIOSGA017902-PA1e-50(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-50nuclear factor Y, subunit B3